Structure of PDB 3fav Chain B

Receptor sequence
>3favB (length=72) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]
GIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSEAYQGVQQKWD
ATATELNNALQNLARTISEAGQ
3D structure
PDB3fav WXG100 protein superfamily consists of three subfamilies and exhibits an alpha-helical C-terminal conserved residue pattern.
ChainB
Resolution2.15 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN B H26 D30 H17 D21
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0042803 protein homodimerization activity
GO:0046812 host cell surface binding
Biological Process
GO:0044315 protein secretion by the type VII secretion system
GO:0052027 symbiont-mediated perturbation of host signal transduction pathway
GO:0052085 symbiont-mediated suppression of host T-cell mediated immune response
Cellular Component
GO:0005576 extracellular region
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0009274 peptidoglycan-based cell wall
GO:0016020 membrane
GO:0020002 host cell plasma membrane
GO:0030430 host cell cytoplasm
GO:0044165 host cell endoplasmic reticulum
GO:0044228 host cell surface

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3fav, PDBe:3fav, PDBj:3fav
PDBsum3fav
PubMed24586681
UniProtP9WNK7|ESXA_MYCTU 6 kDa early secretory antigenic target (Gene Name=esxA)

[Back to BioLiP]