Structure of PDB 3f8f Chain B |
>3f8fB (length=111) Species: 416870 (Lactococcus cremoris subsp. cremoris MG1363) [Search protein sequence] |
PKEMLRAQTNVILLNVLKQGDNYVYGIIKQVKEASNGEMELNEATLYTIF KRLEKDGIISSYWGDESQGGRRKYYRLTEIGHENMRLAFESWSRVDKIIE NLEANKKSEAI |
|
PDB | 3f8f Structure of the transcriptional regulator LmrR and its mechanism of multidrug recognition. |
Chain | B |
Resolution | 2.2 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
DM1 |
B |
V15 W96 |
V11 W92 |
PDBbind-CN: -logKd/Ki=6.63,Kd=236nM |
|
|