Structure of PDB 3f4f Chain B

Receptor sequence
>3f4fB (length=138) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
DKVLKIQLRSASATVPTKGSATAAGYDIYASQDITIPAMGQGMVSTDISF
TVPVGTYGRIAPRSGLAVKNGIQTGAGVVDRDYTGEVKVVLFNHSQRDFA
IKKGDRVAQLILEKIVDDAQIVVVDSLEESARGAGGFG
3D structure
PDB3f4f Structure and activity of the Saccharomyces cerevisiae dUTP pyrophosphatase DUT1, an essential housekeeping enzyme.
ChainB
Resolution2.0 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) G24 A29 Y31 R68 G70 I77 D85
Catalytic site (residue number reindexed from 1) G19 A24 Y26 R63 G65 I72 D80
Enzyme Commision number 3.6.1.23: dUTP diphosphatase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 UMP B R137 G141 F142 G143 R132 G136 F137 G138
BS02 UMP B I65 A81 G82 V83 D85 Y88 K93 I60 A76 G77 V78 D80 Y83 K88
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0004170 dUTP diphosphatase activity
GO:0016787 hydrolase activity
GO:0035870 dITP diphosphatase activity
GO:0046872 metal ion binding
Biological Process
GO:0006226 dUMP biosynthetic process
GO:0009117 nucleotide metabolic process
GO:0009213 pyrimidine deoxyribonucleoside triphosphate catabolic process
GO:0035863 dITP catabolic process
GO:0046081 dUTP catabolic process
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3f4f, PDBe:3f4f, PDBj:3f4f
PDBsum3f4f
PubMed21548881
UniProtP33317|DUT_YEAST Deoxyuridine 5'-triphosphate nucleotidohydrolase (Gene Name=DUT1)

[Back to BioLiP]