Structure of PDB 3f3r Chain B

Receptor sequence
>3f3rB (length=104) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
HMVTQFKTASEFDSAIAQDKLVVVDFYATWCGPSKMIAPMIEKFSEQYPQ
ADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAAIKQAI
AANA
3D structure
PDB3f3r Structural and kinetic analysis of Saccharomyces cerevisiae thioredoxin Trx1: implications for the catalytic mechanism of GSSG reduced by the thioredoxin system
ChainB
Resolution1.8 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) C30 G31 P32 S33
Catalytic site (residue number reindexed from 1) C31 G32 P33 S34
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GSH B W29 C30 P32 A71 M72 W30 C31 P33 A72 M73
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0015035 protein-disulfide reductase activity
GO:0015036 disulfide oxidoreductase activity
Biological Process
GO:0000011 vacuole inheritance
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
GO:0009263 deoxyribonucleotide biosynthetic process
GO:0015031 protein transport
GO:0042144 vacuole fusion, non-autophagic
GO:0045454 cell redox homeostasis
Cellular Component
GO:0000139 Golgi membrane
GO:0000324 fungal-type vacuole
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005758 mitochondrial intermembrane space
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0016020 membrane
GO:0120124 membrane fusion priming complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3f3r, PDBe:3f3r, PDBj:3f3r
PDBsum3f3r
PubMed19362171
UniProtP22217|TRX1_YEAST Thioredoxin-1 (Gene Name=TRX1)

[Back to BioLiP]