Structure of PDB 3f1r Chain B

Receptor sequence
>3f1rB (length=157) Species: 9606 (Homo sapiens) [Search protein sequence]
PGAAQLAHLHGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFI
SVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTY
SSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVP
ELYKDLL
3D structure
PDB3f1r Homodimerization controls the fibroblast growth factor 9 subfamily's receptor binding and heparan sulfate-dependent diffusion in the extracellular matrix
ChainB
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 SO4 B R1140 R1164 R89 R113
Gene Ontology
Molecular Function
GO:0005102 signaling receptor binding
GO:0005104 fibroblast growth factor receptor binding
GO:0008083 growth factor activity
GO:0043395 heparan sulfate proteoglycan binding
GO:0090722 receptor-receptor interaction
Biological Process
GO:0007165 signal transduction
GO:0007267 cell-cell signaling
GO:0008284 positive regulation of cell population proliferation
GO:0008543 fibroblast growth factor receptor signaling pathway
GO:0009887 animal organ morphogenesis
GO:0010628 positive regulation of gene expression
GO:0014059 regulation of dopamine secretion
GO:0030154 cell differentiation
GO:0030334 regulation of cell migration
GO:0042491 inner ear auditory receptor cell differentiation
GO:0043410 positive regulation of MAPK cascade
GO:0043524 negative regulation of neuron apoptotic process
GO:0045664 regulation of neuron differentiation
GO:0060043 regulation of cardiac muscle cell proliferation
GO:0070374 positive regulation of ERK1 and ERK2 cascade
GO:1904340 positive regulation of dopaminergic neuron differentiation
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005737 cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3f1r, PDBe:3f1r, PDBj:3f1r
PDBsum3f1r
PubMed19564416
UniProtQ9NP95|FGF20_HUMAN Fibroblast growth factor 20 (Gene Name=FGF20)

[Back to BioLiP]