Structure of PDB 3eyc Chain B |
>3eycB (length=140) Species: 9606 (Homo sapiens) [Search protein sequence] |
DVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLNLEAKVTMLISGRCQEV KAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYSEGELHGKPVRGVK LVGRDPKNNLEALEDFEKAAGARGLSTESILIPRQSETCS |
|
PDB | 3eyc A new crystal form of human tear lipocalin reveals high flexibility in the loop region and induced fit in the ligand cavity |
Chain | B |
Resolution | 2.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
BU1 |
B |
L41 F99 |
L30 F85 |
|
|
|
|