Structure of PDB 3erx Chain B |
>3erxB (length=123) Species: 82367 (Paracoccus pantotrophus) [Search protein sequence] |
ATHEVHMLNKGESGAMVFEPAFVRAEPGDVINFVPTDKSHNVEAIKEILP EGVESFKSKINESYTLTVTEPGLYGVKCTPHFGMGMVGLVQVGDAPENLD AAKTAKMPKKARERMDAELAQVN |
|
PDB | 3erx The 1.4 A resolution structure of Paracoccus pantotrophus pseudoazurin. |
Chain | B |
Resolution | 1.25 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
B |
H40 C78 H81 M86 |
H40 C78 H81 M86 |
|
|
|
|