Structure of PDB 3epv Chain B |
>3epvB (length=109) Species: 266264 (Cupriavidus metallidurans CH34) [Search protein sequence] |
DLHEILHEAVPLDANEREILELKEDAFAQRRREIETRLRAANGKLADAIA KNPAWSPEVEAATQEVERAAGDLQRATLVHVFEMRAGLKPEHRPAYDRVL IDALRRGSQ |
|
PDB | 3epv X-ray structure of the metal-sensor CnrX in both the apo- and copper-bound forms. |
Chain | B |
Resolution | 1.742 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
B |
H12 H16 E33 H89 |
H3 H7 E24 H80 |
|
|
|