Structure of PDB 3eok Chain B

Receptor sequence

>3eokB (length=146) Species: 8839 (Anas platyrhynchos)

VHWTAEEKQLITGLWGKVNVADCGAEALARLLIVYPWTQRFFASFGNLSS
PTAILGNPMVRAHGKKVLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDP
ENFRLLGDILIIVLAAHFTKDFTPECQAAWQKLVRVVAHALARKYH

3D structure

• PDB: 3eok Structure determination of haemoglobin from Turkey(meleagris gallopavo) at 2.8 Angstrom resolution
• Chain: B
• Resolution: 2.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	T38 F41 F42 H63 L88 H92 L96 N102 F103 L106 L141	T38 F41 F42 H63 L88 H92 L96 N102 F103 L106 L141

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex
• GO:0072562 blood microparticle

External links

• PDB: RCSB:3eok, PDBe:3eok, PDBj:3eok
• PDBsum: 3eok
• UniProt: P02114|HBB_ANAPL Hemoglobin subunit beta (Gene Name=HBB)