Structure of PDB 3em0 Chain B

Receptor sequence
>3em0B (length=135) Species: 7955 (Danio rerio) [Search protein sequence]
SAFNGKWETESQEGYEPFCKLIGIPDDVIAKGRDFKLVTEIVQNGDDFTW
TQYYPNNHVVTNKFIVGKESDMETVGGKKFKGIVSMEGGKLTISFPKYQQ
TTEISGGKLVETSTASGAQGTAVLVRTSKKVLVPR
3D structure
PDB3em0 The X-Ray structure of zebrafish (Danio rerio) ileal bile acid-binding protein reveals the presence of binding sites on the surface of the protein molecule.
ChainB
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CHD B F17 W49 F63 L90 I92 Y97 Q99 T101 F18 W50 F64 L91 I93 Y98 Q100 T102
BS02 CHD B Y14 G31 Y53 Y15 G32 Y54
BS03 CHD B N55 H57 G75 N56 H58 G76
BS04 CHD B I21 K77 F79 F94 Y97 I22 K78 F80 F95 Y98
BS05 CHD B T100 E102 S104 V109 T101 E103 S105 V110
Gene Ontology
Molecular Function
GO:0005504 fatty acid binding
GO:0008289 lipid binding
GO:0032052 bile acid binding
Biological Process
GO:0015908 fatty acid transport
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3em0, PDBe:3em0, PDBj:3em0
PDBsum3em0
PubMed18952094
UniProtQ6IMW5

[Back to BioLiP]