Structure of PDB 3elv Chain B |
>3elvB (length=144) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] |
KHVEPQDAISPDNYMDMLGLEARDRTMYELVIYRKNDKDKGPWKRYDLNG RSCYLVGRELGTEIVVADIGIPEETSSKQHCVIQFRNVRGILKCYVMDLD SSNGTCLNNVVIPGARYIELRSGDVLTLSEFEEDNDYELIFMNV |
|
PDB | 3elv Crystal structure of the Pml1p subunit of the yeast precursor mRNA retention and splicing complex. |
Chain | B |
Resolution | 2.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
SO4 |
B |
R108 S137 K138 |
R58 S77 K78 |
|
|
|
|