Structure of PDB 3egt Chain B

Receptor sequence

>3egtB (length=359) Species: 5691 (Trypanosoma brucei) [Search protein sequence]

MPMQMFMQVYDEIQMFLLEELELKFDMDPNRVRYLRKMMDTTCLGGKYNR
GLTVIDVAESLLSLDDGARRKRVLHDACVCGWMIEFLQAHYLVEDDIMDN
SVTRRGKPCWYRHPDVTVQCAINDGLLLKSWTHMMAMHFFADRPFLQDLL
CRFNRVDYTTAVGQLYDVTSMFDSNKLDPDVSQPTTTDFAEFTLSNYKRI
VKYKTAYYTYLLPLVMGLIVSEALPTVDMGVTEELAMLMGEYFQVQDDVM
DCFTPPERLGKVGTDIQDAKCSWLAVTFLAKASSAQVAEFKANYGSGDSE
KVATVRRLYEEADLQGDYVAYEAAVAEQVKELIEKLRLCSPGFAASVETL
WGKTYKRQK

3D structure

PDB

3egt Lipophilic bisphosphonates as dual farnesyl/geranylgeranyl diphosphate synthase inhibitors: an X-ray and NMR investigation.

Chain

Resolution

2.0 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	M1 E20 E22 D28 C43 K47 Y48 V54 I55 D56 V57 A58 L62 H98 D103 D107 R112 R160 T167 D175 D188 Y211 K212 F251 D255 D256 V270 A277 A293 E297 S304 E308 E318
Catalytic site (residue number reindexed from 1)	M1 E20 E22 D28 C43 K47 Y48 V54 I55 D56 V57 A58 L62 H90 D95 D99 R104 R152 T159 D167 D180 Y203 K204 F243 D247 D248 V262 A269 A285 E289 S296 E300 E310
Enzyme Commision number	2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	722	B	N131 L134	N123 L126	MOAD: Ki=1.26nM PDBbind-CN: -logKd/Ki=8.90,Ki=1.26nM
BS02	MG	B	D103 D107	D95 D99
BS03	MG	B	D103 D107	D95 D99
BS04	722	B	Y99 E102 D103 M106 D107 R112 Q172 K212 D255 K269	Y91 E94 D95 M98 D99 R104 Q164 K204 D247 K261	MOAD: Ki=1.26nM PDBbind-CN: -logKd/Ki=8.90,Ki=1.26nM

Gene Ontology

	Molecular Function
GO:0004161	dimethylallyltranstransferase activity
GO:0004337	geranyltranstransferase activity
GO:0004659	prenyltransferase activity
GO:0016740	transferase activity
GO:0016765	transferase activity, transferring alkyl or aryl (other than methyl) groups
GO:0046872	metal ion binding

	Biological Process
GO:0008299	isoprenoid biosynthetic process
GO:0045337	farnesyl diphosphate biosynthetic process

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3egt, PDBe:3egt, PDBj:3egt
PDBsum	3egt
PubMed	19309137
UniProt	Q86C09

[Back to BioLiP]