Structure of PDB 3eei Chain B

Receptor sequence

>3eeiB (length=231) Species: 491 (Neisseria meningitidis serogroup B)

LKTVAVIGAMEQEIELLREMMENVKAVSFGRFSAYEGELAGKRMVLALSG
IGKVNAAVATAWIIREFAADCVINTGSAGGLGKGLKVGDVVIGTETAHHD
VDVTAFGYAWGQVPQLPARFASDGILIEAAKRAARTFEGAAVEQGLIVSG
DRFVHSSEGVAEIRKHFPEVKAVEMEAAAIAQTCHQLETPFVIIRAVSDS
ADEKADISFDEFLKTAAANSAKMVAEIVKSL

3D structure

• PDB: 3eei Crystal structure of 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase from neisseria meningitidis in complex with methylthio-immucillin-A
• Chain: B
• Resolution: 1.78 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): W64
• Catalytic site (residue number reindexed from 1): W62
• Enzyme Commision number: 3.2.2.9: adenosylhomocysteine nucleosidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MTM	B	S79 A80 G81 F155 V156 E176 M177 E178 D201 A203 F211	S77 A78 G79 F153 V154 E174 M175 E176 D199 A201 F209

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0008782 adenosylhomocysteine nucleosidase activity
• GO:0008930 methylthioadenosine nucleosidase activity
• GO:0016798 hydrolase activity, acting on glycosyl bonds

Biological Process

• GO:0009086 methionine biosynthetic process
• GO:0009116 nucleoside metabolic process
• GO:0009164 nucleoside catabolic process
• GO:0019284 L-methionine salvage from S-adenosylmethionine
• GO:0019509 L-methionine salvage from methylthioadenosine

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:3eei, PDBe:3eei, PDBj:3eei
• PDBsum: 3eei
• UniProt: Q9K054