Structure of PDB 3e54 Chain B

Receptor sequence

>3e54B (length=159) Species: 164451 (Vulcanisaeta distributa)

EEDFKEGYILGFIEAEGSFSVSIKFQRDVFGGVRLDPVFSITQKNREVLE
AIKEHLGIGRIMEKAGQPNTYVYVVDNFNELVKLINFLNKYADFMIVKKR
QFLMFREIANGLVNGEHLHINGLKRLVKLAYELTKESEKGYRKYDLNHVL
SIIDKWDLG

3D structure

• PDB: 3e54 Recognition of a common rDNA target site in archaea and eukarya by analogous LAGLIDADG and His-Cys box homing endonucleases
• Chain: B
• Resolution: 2.5 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	E219 T245 Q246 K247 Q270 K342	E16 T42 Q43 K44 Q67 K139
BS02	dna	B	S221 S223 S225 I226 K227 R237 K267 K301 T337 S340 K342 G343 Y344 R345 K346	S18 S20 S22 I23 K24 R34 K64 K98 T134 S137 K139 G140 Y141 R142 K143
BS03	dna	B	Q229 D231 V232 R237 R263 A268 N280 F281 H320 E341 K342 Y344	Q26 D28 V29 R34 R60 A65 N77 F78 H117 E138 K139 Y141
BS04	MG	B	E219 Q246	E16 Q43

Gene Ontology

Molecular Function

• GO:0004519 endonuclease activity
• GO:0046872 metal ion binding

External links

• PDB: RCSB:3e54, PDBe:3e54, PDBj:3e54
• PDBsum: 3e54
• PubMed: 18984620
• UniProt: Q6L703