Structure of PDB 3e45 Chain B

Receptor sequence

>3e45B (length=249) Species: 727 (Haemophilus influenzae)

SFIKPIYQDINSILIGQKVKRGHAAGEPFEKLVYKFLKENLSDLTFKQYE
YLNDLFMKNPAIIGHEARYKLFNSPTLLFLLSRGKAATENWSIENLFEEK
QNDTADILLVKDQFYELLDVKTRNISKSAFAPNIISAYKLAQTCAKMIDN
KEFDLFDINYLEVDWELNGEDLVCVSTSFAELFKSEPSELYINWAAAMQI
QFHVRDLDQGFNGTREEWAKSYLKHFVTQAEQRAISMIDKFVKPFKKYI

3D structure

• PDB: 3e45 DNA distortion and specificity in a sequence-specific endonuclease.
• Chain: B
• Resolution: 2.78 Å

Enzymatic activity

• Enzyme Commision number: 3.1.21.4: type II site-specific deoxyribonuclease.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	H31 A33 Q109 N110 D127 K129 S136 A137 F138 P140 N141 S144 Y146 K147 A205 Q207	H23 A25 Q101 N102 D119 K121 S128 A129 F130 P132 N133 S136 Y138 K139 A197 Q199
BS02	dna	B	H31 G92 K93 F138 Y199 N201 A203 A204 R241	H23 G84 K85 F130 Y191 N193 A195 A196 R233
BS03	CA	B	D114 D127 V128	D106 D119 V120

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0004519 endonuclease activity
• GO:0009036 type II site-specific deoxyribonuclease activity

Biological Process

• GO:0009307 DNA restriction-modification system

External links

• PDB: RCSB:3e45, PDBe:3e45, PDBj:3e45
• PDBsum: 3e45
• PubMed: 18762194
• UniProt: P17743|T2C2_HAEIF Type II restriction enzyme HincII (Gene Name=hincIIR)