Structure of PDB 3e44 Chain B

Receptor sequence

>3e44B (length=241) Species: 727 (Haemophilus influenzae)

SFIKPIYQDINSILIGQKVPFEKLVYKFLKENLSDLTFKQYEYLNDLFMK
NPAIIGHEARYKLFNSPTLLFLLSRGKAATENWSIENLFEEKQNDTADIL
LVKDQFYELLDVKTRNISKSAFAPNIISAYKLAQTCAKMIDNKEFDLFDI
NYLEVDWELNGEDLVCVSTSFAELFKSEPSELYINWAAAMQIQFHVRDLD
QGFNGTREEWAKSYLKHFVTQAEQRAISMIDKFVKPFKKYI

3D structure

• PDB: 3e44 DNA distortion and specificity in a sequence-specific endonuclease.
• Chain: B
• Resolution: 2.52 Å

Enzymatic activity

• Enzyme Commision number: 3.1.21.4: type II site-specific deoxyribonuclease.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	Q109 N110 D111 S144 Y146 K147 Q207	Q93 N94 D95 S128 Y130 K131 Q191
BS02	dna	B	D114 K129 T130 A137 F138 P140 N141	D98 K113 T114 A121 F122 P124 N125
BS03	dna	B	F138 Y199 N201 A203 A204 R241	F122 Y183 N185 A187 A188 R225
BS04	dna	B	G92 K93 Q109	G76 K77 Q93
BS05	MN	B	D114 V128	D98 V112
BS06	MN	B	T112 A113 D114 D127	T96 A97 D98 D111

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0004519 endonuclease activity
• GO:0009036 type II site-specific deoxyribonuclease activity

Biological Process

• GO:0009307 DNA restriction-modification system

External links

• PDB: RCSB:3e44, PDBe:3e44, PDBj:3e44
• PDBsum: 3e44
• PubMed: 18762194
• UniProt: P17743|T2C2_HAEIF Type II restriction enzyme HincII (Gene Name=hincIIR)