Structure of PDB 3e40 Chain B

Receptor sequence

>3e40B (length=241) Species: 727 (Haemophilus influenzae)

SFIKPIYQDINSILIGQKVKREKLVYKFLKENLSDLTFKQYEYLNDLFMK
NPAIIGHEARYKLFNSPTLLFLLSRGKAATENWSIENLFEEKNDTADILL
VKDQFYELLDVKTRNISKSAFAPNIISAYKLAQTCAKMIDNKEFDLFDIN
YLEVDWELNGEDLVCVSTSFAELFKSEPSELYINWAAAMQIQFHVRDLDQ
GFNGTREEWAKSYLKHFVTQAEQRAISMIDKFVKPFKKYIL

3D structure

• PDB: 3e40 DNA distortion and specificity in a sequence-specific endonuclease.
• Chain: B
• Resolution: 2.1 Å

Enzymatic activity

• Enzyme Commision number: 3.1.21.4: type II site-specific deoxyribonuclease.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	N110 D111 K129 T130 S136 A137 F138 P140 N141 S144 Y146 K147 A205 M206 Q207	N93 D94 K112 T113 S119 A120 F121 P123 N124 S127 Y129 K130 A188 M189 Q190
BS02	dna	B	G92 K93 F138 Y199 N201 A203 A204 R241 K248	G76 K77 F121 Y182 N184 A186 A187 R224 K231
BS03	CA	B	D114 D127 V128	D97 D110 V111

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0004519 endonuclease activity
• GO:0009036 type II site-specific deoxyribonuclease activity

Biological Process

• GO:0009307 DNA restriction-modification system

External links

• PDB: RCSB:3e40, PDBe:3e40, PDBj:3e40
• PDBsum: 3e40
• PubMed: 18762194
• UniProt: P17743|T2C2_HAEIF Type II restriction enzyme HincII (Gene Name=hincIIR)