Structure of PDB 3e2h Chain B |
>3e2hB (length=109) Species: 10090 (Mus musculus) [Search protein sequence] |
SVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGPQLLLKYYS GDPVVQGVNGFEAEFSKSNSSFHLRKASVHRSDSAVYFCAVSLERPYLTF GSGTKVIVL |
|
PDB | 3e2h Distinct CDR3 Conformations in TCRs Determine the Level of Cross-Reactivity for Diverse Antigens, but Not the Docking Orientation |
Chain | B |
Resolution | 3.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
B |
R101 P102 |
R95 P96 |
|
|
|
|