Structure of PDB 3dwi Chain B

Receptor sequence

>3dwiB (length=309) Species: 83332 (Mycobacterium tuberculosis H37Rv)

MTRYDSLLQALGNTPLVGLQRLSPRWDDGRDGPHVRLWAKLEDRNPTGSI
KDRPAVRMIEQAEADGLLRPGATILEPTSGNTGISLAMAARLKGYRLICV
MPENTSVERRQLLELYGAQIIFSAASNTAVATAKELAATNPSWVMLYQYG
NPANTDSHYCGTGPELLADLPEITHFVAGLGTTGTLMGTGRFLREHVANV
AIVAAEPRYGEGVYALRNMDEGFVPELYDPEILTARYSVGAVDAVRRTRE
LVHTEGIFAGISTGAVLHAALGVGAGALAAGERADIALVVADAGWKYLST
GAYAGSLDD

3D structure

• PDB: 3dwi Crystal structure of a sulfur carrier protein complex found in the cysteine biosynthetic pathway of Mycobacterium tuberculosis.
• Chain: B
• Resolution: 2.81 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K51 S265
• Catalytic site (residue number reindexed from 1): K51 S262
• Enzyme Commision number: 2.5.1.113: [CysO sulfur-carrier protein]-thiocarboxylate-dependent cysteine synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PLP	B	K51 N81 G184 T185 T186 G187 T188 A218 L219 S265 A294 D295	K51 N81 G181 T182 T183 G184 T185 A215 L216 S262 A291 D292

Gene Ontology

Molecular Function

• GO:0004124 cysteine synthase activity
• GO:0005515 protein binding
• GO:0016740 transferase activity
• GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups
• GO:0030170 pyridoxal phosphate binding
• GO:0033847 O-phosphoserine sulfhydrylase activity

Biological Process

• GO:0006535 cysteine biosynthetic process from serine
• GO:0019344 cysteine biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0032991 protein-containing complex

External links

• PDB: RCSB:3dwi, PDBe:3dwi, PDBj:3dwi
• PDBsum: 3dwi
• PubMed: 18771296
• UniProt: P9WP53|CYSM_MYCTU O-phosphoserine sulfhydrylase (Gene Name=cysM)