Structure of PDB 3did Chain B

Receptor sequence

>3didB (length=115) Species: 9606 (Homo sapiens)

CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLT
TEEEFVEGIYKVEIDTKSYWKALGISPMHEHAEVVFTANDSGPRRYTIAA
MLSPYSYSTTAVVTN

3D structure

• PDB: 3did Novel Zn2+-binding sites in human transthyretin: implications for amyloidogenesis and retinol-binding protein recognition.
• Chain: B
• Resolution: 1.78 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	C10 H56	C1 H47
BS02	ZN	B	H31 D74	H22 D65
BS03	ZN	B	H88 H90 E92	H79 H81 E83

Gene Ontology

Molecular Function

• GO:0005179 hormone activity
• GO:0005515 protein binding
• GO:0042802 identical protein binding
• GO:0070324 thyroid hormone binding

Biological Process

• GO:0006144 purine nucleobase metabolic process
• GO:0007165 signal transduction

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005737 cytoplasm
• GO:0035578 azurophil granule lumen
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:3did, PDBe:3did, PDBj:3did
• PDBsum: 3did
• PubMed: 20659897
• UniProt: P02766|TTHY_HUMAN Transthyretin (Gene Name=TTR)