Structure of PDB 3dfx Chain B

Receptor sequence
>3dfxB (length=58) Species: 10090 (Mus musculus) [Search protein sequence]
SAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMK
KEGIQTRN
3D structure
PDB3dfx Crystal structures of multiple GATA zinc fingers bound to DNA reveal new insights into DNA recognition and self-association by GATA.
ChainB
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B R329 R330 R364 N365 R22 R23 R57 N58
BS02 dna B T326 N339 L343 H348 R352 M356 Q362 T363 R364 T19 N32 L36 H41 R45 M49 Q55 T56 R57
BS03 ZN B C317 C320 C338 C341 C10 C13 C31 C34
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3dfx, PDBe:3dfx, PDBj:3dfx
PDBsum3dfx
PubMed18621058
UniProtP23772|GATA3_MOUSE Trans-acting T-cell-specific transcription factor GATA-3 (Gene Name=Gata3)

[Back to BioLiP]