Structure of PDB 3d6f Chain B |
>3d6fB (length=88) Species: 9606 (Homo sapiens) [Search protein sequence] |
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDV EEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH |
|
PDB | 3d6f Mutated, structurally altered caspase-1 with decreased enzymatic and increased RIP2-meditated inflammatory activity leads to a new type of periodic fever (ICE fever). |
Chain | B |
Resolution | 1.9 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
E390 |
Catalytic site (residue number reindexed from 1) |
E74 |
Enzyme Commision number |
3.4.22.36: caspase-1. |
|
|
|
|