Structure of PDB 3d3w Chain B

Receptor sequence
>3d3wB (length=244) Species: 9606 (Homo sapiens) [Search protein sequence]
MELFLAGRRVLVTGAGKGIGRGTVQALHATGARVVAVSRTQADLDSLVRE
CPGIEPVCVDLGDWEATERALGSVGPVDLLVNNAAVALLQPFLEVTKEAF
DRSFEVNLRAVIQVSQIVARGLIARGVPGAIVNVSSQCSQRAVTNHSVYC
STKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTM
LNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEGGFWAC
3D structure
PDB3d3w Structure/function analysis of a critical disulfide bond in the active site of L-xylulose reductase.
ChainB
Resolution1.87 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) G18 S136 H146 Y149 K153
Catalytic site (residue number reindexed from 1) G18 S136 H146 Y149 K153
Enzyme Commision number 1.1.1.10: L-xylulose reductase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NAP B G14 G16 K17 G18 I19 S38 R39 T40 V59 D60 L61 N83 A85 V106 V134 S135 S136 Y149 K153 V182 T184 S185 G14 G16 K17 G18 I19 S38 R39 T40 V59 D60 L61 N83 A85 V106 V134 S135 S136 Y149 K153 V182 T184 S185
Gene Ontology
Molecular Function
GO:0004090 carbonyl reductase (NADPH) activity
GO:0005515 protein binding
GO:0016491 oxidoreductase activity
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors
GO:0016655 oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor
GO:0042802 identical protein binding
GO:0050038 L-xylulose reductase (NADPH) activity
Biological Process
GO:0005997 xylulose metabolic process
GO:0006006 glucose metabolic process
GO:0006739 NADP metabolic process
GO:0019640 D-glucuronate catabolic process to D-xylulose 5-phosphate
GO:0042732 D-xylose metabolic process
GO:2000379 positive regulation of reactive oxygen species metabolic process
Cellular Component
GO:0005634 nucleus
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0005881 cytoplasmic microtubule
GO:0005886 plasma membrane
GO:0005902 microvillus
GO:0005903 brush border
GO:0016020 membrane
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3d3w, PDBe:3d3w, PDBj:3d3w
PDBsum3d3w
PubMed19337691
UniProtQ7Z4W1|DCXR_HUMAN L-xylulose reductase (Gene Name=DCXR)

[Back to BioLiP]