Structure of PDB 3cxk Chain B

Receptor sequence
>3cxkB (length=131) Species: 320372 (Burkholderia pseudomallei 1710b) [Search protein sequence]
YPYPKDDAELRRRLTPMQYEVTQHAATEPPFTGEYTDTEDAGIYHCVVCG
TALFESGAKYHSGCGWPSYFKPIDGEVIDEKMDYTHGMTRVEVRCNQCGA
HLGHVFEDGPRDKTGLRYCINSAALNFEAKP
3D structure
PDB3cxk The plug-based nanovolume Microcapillary Protein Crystallization System (MPCS).
ChainB
Resolution1.7 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) C73 H110 H113 D117 R126 C128
Catalytic site (residue number reindexed from 1) C64 H101 H104 D108 R117 C119
Enzyme Commision number 1.8.4.12: peptide-methionine (R)-S-oxide reductase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN B C55 C58 C104 C107 C46 C49 C95 C98
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0016491 oxidoreductase activity
GO:0016671 oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor
GO:0033743 peptide-methionine (R)-S-oxide reductase activity
GO:0046872 metal ion binding
Biological Process
GO:0006979 response to oxidative stress
GO:0030091 protein repair
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3cxk, PDBe:3cxk, PDBj:3cxk
PDBsum3cxk
PubMed19020349
UniProtQ3JRF0|MSRB_BURP1 Peptide methionine sulfoxide reductase MsrB (Gene Name=msrB)

[Back to BioLiP]