Structure of PDB 3cvd Chain B |
>3cvdB (length=104) Species: 32059 (Phormidium laminosum) [Search protein sequence] |
ETFTVKMGADSGLFQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPG ASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGK ITVE |
|
PDB | 3cvd Regulation of protein function: crystal packing interfaces and conformational dimerization. |
Chain | B |
Resolution | 1.5 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU1 |
B |
H39 C89 M97 |
H39 C89 M97 |
|
|
|
|