Structure of PDB 3cv6 Chain B

Receptor sequence
>3cv6B (length=323) Species: 10090 (Mus musculus) [Search protein sequence]
MNSKCHCVILNDGNFIPVLGFGTALPLECPKSKAKELTKIAIDAGFHHFD
SASVYNTEDHVGEAIRSKIADGTVRREDIFYTSKVWCTSLHPELVRASLE
RSLQKLQFDYVDLYLIHYPMALKPGEENFPVDEHGKLIFDRVDLCATWEA
MEKCKDAGLTKSIGVSNFNYRQLEMILNKPGLKYKPVCNQVECHPYLNQM
KLLDFCKSKDIVLVAYGVLGTQRYPPWVDQNSPVLLDEPVLGSMAKKYNR
TPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVLDGLN
RNMRYIPAAIFKGHPNWPFLDEY
3D structure
PDB3cv6 Structure of the G225P/G226P mutant of mouse 3(17)alpha-hydroxysteroid dehydrogenase (AKR1C21) ternary complex: implications for the binding of inhibitor and substrate.
ChainB
Resolution2.1 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D50 Y55 K84 H117
Catalytic site (residue number reindexed from 1) D50 Y55 K84 H117
Enzyme Commision number 1.1.1.-
1.1.1.209: 3(or 17)alpha-hydroxysteroid dehydrogenase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NAP B G22 A24 D50 Y55 Q190 Y216 G217 L219 T221 Q222 Y224 A253 T270 S271 K273 R276 E279 N280 G22 A24 D50 Y55 Q190 Y216 G217 L219 T221 Q222 Y224 A253 T270 S271 K273 R276 E279 N280
BS02 HXS B A24 L25 Y55 H117 Y118 Y224 W227 A24 L25 Y55 H117 Y118 Y224 W227 MOAD: ic50=50uM
Gene Ontology
Molecular Function
GO:0004033 aldo-keto reductase (NADPH) activity
GO:0005496 steroid binding
GO:0016491 oxidoreductase activity
GO:0033764 steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0047023 androsterone dehydrogenase activity
GO:0047024 5alpha-androstane-3beta,17beta-diol dehydrogenase activity
GO:0070401 NADP+ binding
GO:0070402 NADPH binding
GO:0072555 17-beta-ketosteroid reductase (NADPH) activity
GO:0072582 17-beta-hydroxysteroid dehydrogenase (NADP+) activity
GO:1902121 lithocholic acid binding
Biological Process
GO:0006694 steroid biosynthetic process
GO:0008202 steroid metabolic process
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3cv6, PDBe:3cv6, PDBj:3cv6
PDBsum3cv6
PubMed19237748
UniProtQ91WR5|AK1CL_MOUSE Aldo-keto reductase family 1 member C21 (Gene Name=Akr1c21)

[Back to BioLiP]