Structure of PDB 3cun Chain B

Receptor sequence
>3cunB (length=91) Species: 9606 (Homo sapiens) [Search protein sequence]
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQA
FVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK
3D structure
PDB3cun Structural basis of specific tRNA aminoacylation by a small in vitro selected ribozyme.
ChainB
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B Y408 N410 N411 E414 S443 L444 K445 M446 R447 Q449 F451 R478 Q480 A482 K483 T484 D485 S486 D487 Y8 N10 N11 E14 S43 L44 K45 M46 R47 Q49 F51 R78 Q80 A82 K83 T84 D85 S86 D87
BS02 CO B H426 S430 Q434 I435 H26 S30 Q34 I35
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:3cun, PDBe:3cun, PDBj:3cun
PDBsum3cun
PubMed18548004
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]