Structure of PDB 3crx Chain B

Receptor sequence

>3crxB (length=323) Species: 10678 (Punavirus P1)

TSDEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWAAWCKLNNRKWFPAEP
EDVRDYLLYLQARGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMR
RIRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRNLAFLGIAY
NTLLKIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVT
KLVERWISVSGVADDPNNYLFCRVRKNGVAAPSATSQLSTRALEGIFEAT
HRLIYGAKDDSGQRYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNV
NIVMNYIRNLDSETGAMVRLLED

3D structure

• PDB: 3crx Structure of the Holliday junction intermediate in Cre-loxP site-specific recombination.
• Chain: B
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	M44 S47 R50 R81 L83 A84 K86 T87 Q90 K132 Q156 R159 T202 R241 V242 K244 L256 S257 R259 R282 R292 W315 T316 I320 Y324	M26 S29 R32 R63 L65 A66 K68 T69 Q72 K114 Q138 R141 T184 R223 V224 K226 L238 S239 R241 R264 R274 W297 T298 I302 Y306
BS02	dna	B	F37 S38 H40 T41 K43 M97 R100 R101 R106 K173 I174 A175 K201 R243 K244 N245 R259 E262 K276 R282 Y283 S287 G288 H289	F19 S20 H22 T23 K25 M79 R82 R83 R88 K155 I156 A157 K183 R225 K226 N227 R241 E244 K258 R264 Y265 S269 G270 H271

Gene Ontology

Molecular Function

• GO:0003677 DNA binding

Biological Process

• GO:0006310 DNA recombination
• GO:0015074 DNA integration

External links

• PDB: RCSB:3crx, PDBe:3crx, PDBj:3crx
• PDBsum: 3crx
• PubMed: 9670032
• UniProt: P06956|RECR_BPP1 Recombinase cre (Gene Name=cre)