Structure of PDB 3crf Chain B

Receptor sequence
>3crfB (length=144) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence]
GSFLPNSEQQKSVDIVFSSPQDLTVSLIPVSGLKAGKNAPSAKIAKLVVN
STTLKEFGVRGISNNVVDSTGTAWRVAGKNTGKEIGVGLSSDSLRRSDST
EKWNGVNWMTFNSNDTLDIVLTGPAQNVTADTYPITLDVVGYQP
3D structure
PDB3crf Structural analysis of the Saf pilus by electron microscopy and image processing.
ChainB
Resolution17.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B P20 Q21 L23 L27 P29 L33 K34 A35 K79 W103 W108 V128 A130 D131 T132 Y133 P134 I135 T136 L137 D138 V139 G141 Y142 Q143 P20 Q21 L23 L27 P29 L33 K34 A35 K79 W103 W108 V128 A130 D131 T132 Y133 P134 I135 T136 L137 D138 V139 G141 Y142 Q143
External links