Structure of PDB 3cq3 Chain B |
>3cq3B (length=98) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] |
NPLEAQAWALLEAVYDPELGLDVVNLGLIYDLVVEPPRAYVRMTLTTPGC PLHDSLGEAVRQALSRLPGVEEVEVEVTFEPPWTLARLSEKARRLLGW |
|
PDB | 3cq3 Structure of the DTDP-4-Keto-L-Rhamnose Reductase related protein (other form) from Thermus Thermophilus HB8 |
Chain | B |
Resolution | 2.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
B |
T88 R91 |
T84 R87 |
|
|
|