Structure of PDB 3cpj Chain B

Receptor sequence
>3cpjB (length=164) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
YDLLFKIVLIGDSGVGKSNLLSRFTKNEFNMGVEFATRTLEIEGKRIKAQ
IWDTAGQERYRAITSAYYRGAVGALIVYDSKSSSYENCNHWLSELRENAD
VAVGLIGNKSDLAHLRAVPTEESKTFAQENQLLFTETSALSENVDKAFEE
LINTIYQKVPTISL
3D structure
PDB3cpj A structural model of the GDP dissociation inhibitor rab membrane extraction mechanism.
ChainB
Resolution2.35 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GDP B G23 G25 K26 S27 N28 F38 N39 M40 N126 K127 D129 L130 A157 L158 G14 G16 K17 S18 N19 F29 N30 M31 N108 K109 D111 L112 A139 L140 PDBbind-CN: -logKd/Ki=4.72,Kd=18.9uM
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
Biological Process
GO:0006887 exocytosis
GO:0006914 autophagy
GO:0015031 protein transport
GO:0016192 vesicle-mediated transport
GO:0034498 early endosome to Golgi transport
Cellular Component
GO:0000139 Golgi membrane
GO:0005739 mitochondrion
GO:0005741 mitochondrial outer membrane
GO:0005768 endosome
GO:0005794 Golgi apparatus
GO:0005802 trans-Golgi network
GO:0005829 cytosol
GO:0016020 membrane
GO:0055037 recycling endosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3cpj, PDBe:3cpj, PDBj:3cpj
PDBsum3cpj
PubMed18426803
UniProtP38555|YPT31_YEAST GTP-binding protein YPT31/YPT8 (Gene Name=YPT31)

[Back to BioLiP]