Structure of PDB 3cn0 Chain B

Receptor sequence

>3cn0B (length=114) Species: 9606 (Homo sapiens)

PLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTT
EEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAAL
LSPYSYSTTAVVTN

3D structure

• PDB: 3cn0 Toward optimization of the linker substructure common to transthyretin amyloidogenesis inhibitors using biochemical and structural studies.
• Chain: B
• Resolution: 1.52 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	LJ1	B	K15 L110 S117 T118	K5 L100 S107 T108	PDBbind-CN: -logKd/Ki=5.51,IC50=3.08uM BindingDB: IC50=3080nM

Gene Ontology

Molecular Function

• GO:0005179 hormone activity
• GO:0005515 protein binding
• GO:0042802 identical protein binding
• GO:0070324 thyroid hormone binding

Biological Process

• GO:0006144 purine nucleobase metabolic process
• GO:0007165 signal transduction

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005737 cytoplasm
• GO:0035578 azurophil granule lumen
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:3cn0, PDBe:3cn0, PDBj:3cn0
• PDBsum: 3cn0
• PubMed: 18811132
• UniProt: P02766|TTHY_HUMAN Transthyretin (Gene Name=TTR)