Structure of PDB 3ciu Chain B

Receptor sequence

>3ciuB (length=145) Species: 9913 (Bos taurus)

MLTAEEKAAVTAFWGKVKVDEVGGEALGRLLVVYPWTQRFFESFGDLSTA
DAVMNNPKVKAHGKKVLDSFSNGMKHLDDLKGTFAALSELHCDKLHVDPE
NFKLLGNVLVVVLARNFGKEFTPVLQADFQKVVAGVANALAHRYH

3D structure

• PDB: 3ciu Site-Selective Glycosylation of Cysteine-93 beta on the Surface of Bovine Hemoglobin and its Application as a Novel Oxygen Therapeutic
• Chain: B
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	F41 F42 H63 V67 L88 H92 L96 V98 N102 F103 L106 L141	F40 F41 H62 V66 L87 H91 L95 V97 N101 F102 L105 L140
BS02	5DP	B	C93 D94	C92 D93

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0031721 hemoglobin alpha binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex

External links

• PDB: RCSB:3ciu, PDBe:3ciu, PDBj:3ciu
• PDBsum: 3ciu
• UniProt: P02070|HBB_BOVIN Hemoglobin subunit beta (Gene Name=HBB)