Structure of PDB 3cif Chain B

Receptor sequence

>3cifB (length=338) Species: 5807 (Cryptosporidium parvum)

TATLGINGFGRIGRLVLRACMERNDITVVAINDPFMDVEYMAYLLKYDSV
HGNFNGTVEVSGKDLCINGKVVKVFQAKDPAEIPWGASGAQIVCESTGVF
TTEEKASLHLKGGAKKVIISAPPKDNVPMYVMGVNNTEYDPSKFNVISNA
SSTTNCLAPLAKIINDKFGIVEGLMTTVHSLTANQLTVDGPSKGGKDWRA
GRCAGNNIIPASTGAAKAVGKVIPALNGKLTGMAIRVPTPDVSVVDLTCK
LAKPASIEEIYQAVKEASNGPMKGIMGYTSDDVVSTDFIGCKYSSILDKN
ACIALNDSFVKLISWYDNESGYSNRLVDLAVYVASRGL

3D structure

• PDB: 3cif An unexpected phosphate binding site in Glyceraldehyde 3-Phosphate Dehydrogenase: Crystal structures of apo, holo and ternary complex of Cryptosporidium parvum enzyme
• Chain: B
• Resolution: 2.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): S153 H180
• Catalytic site (residue number reindexed from 1): S152 H179
• Enzyme Commision number: 1.2.1.12: glyceraldehyde-3-phosphate dehydrogenase (phosphorylating).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	G3H	B	S152 S153 T154 H180 T214 G215 R237	S151 S152 T153 H179 T213 G214 R236
BS02	NAD	B	N8 G9 G11 R12 I13 N33 D34 P35 F36 T98 G99 F101 S121 S153 A184 N319 Y323	N7 G8 G10 R11 I12 N32 D33 P34 F35 T97 G98 F100 S120 S152 A183 N318 Y322
BS03	MG	B	C21 R24 I27	C20 R23 I26

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0004365 glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity
• GO:0016491 oxidoreductase activity
• GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
• GO:0042802 identical protein binding
• GO:0050661 NADP binding
• GO:0051287 NAD binding

Biological Process

• GO:0006006 glucose metabolic process
• GO:0006096 glycolytic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:3cif, PDBe:3cif, PDBj:3cif
• PDBsum: 3cif
• PubMed: 19243605
• UniProt: Q7YYQ9