Structure of PDB 3cbb Chain B

Receptor sequence
>3cbbB (length=78) Species: 9606 (Homo sapiens) [Search protein sequence]
ALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKD
KRNQCRYCRLKKCFRAGMKKEAVQNERD
3D structure
PDB3cbb Structural basis of natural promoter recognition by a unique nuclear receptor, HNF4alpha. Diabetes gene product.
ChainB
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B K61 Y63 R76 R80 Q122 E124 R125 D126 K13 Y15 R28 R32 Q74 E76 R77 D78
BS02 dna B G70 R77 H83 R100 N101 R104 R107 G22 R29 H35 R52 N53 R56 R59
BS03 ZN B C51 C54 C71 C3 C6 C23
BS04 ZN B C87 C93 C103 C106 C39 C45 C55 C58
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3cbb, PDBe:3cbb, PDBj:3cbb
PDBsum3cbb
PubMed18829458
UniProtP41235|HNF4A_HUMAN Hepatocyte nuclear factor 4-alpha (Gene Name=HNF4A)

[Back to BioLiP]