Structure of PDB 3c75 Chain B |
>3c75B (length=106) Species: 34007 (Paracoccus versutus) [Search protein sequence] |
QDKITVTSEKPVAAADVPADAVVVGIEKMKYLTPEVTIKAGETVYWVNGE VMPHNVAFKKGIVGEDAFRGEMMTKDQAYAITFNEAGSYDYFCTPHPFMR GKVIVE |
|
PDB | 3c75 Structural comparison of crystal and solution states of the 138 kDa complex of methylamine dehydrogenase and amicyanin from Paracoccus versutus. |
Chain | B |
Resolution | 2.5 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
V23 I62 E65 |
Catalytic site (residue number reindexed from 1) |
V23 I62 E65 |
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
B |
H54 C93 H96 M99 |
H54 C93 H96 M99 |
|
|
|
|