Structure of PDB 3bxq Chain B

Receptor sequence

>3bxqB (length=30) Species: 9606 (Homo sapiens)

FVNQRLCGSHLVEALYLVCGERGFFYTPKT

3D structure

• PDB: 3bxq The structure of a mutant insulin uncouples receptor binding from protein allostery. An electrostatic block to the TR transition.
• Chain: B
• Resolution: 1.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	F1 N3 Q4 R5 L6 C7 L11 C19 R22 G23 F24 F25 Y26 T27 P28 K29	F1 N3 Q4 R5 L6 C7 L11 C19 R22 G23 F24 F25 Y26 T27 P28 K29

Gene Ontology

Molecular Function

• GO:0005179 hormone activity

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:3bxq, PDBe:3bxq, PDBj:3bxq
• PDBsum: 3bxq
• PubMed: 18492668
• UniProt: P01308|INS_HUMAN Insulin (Gene Name=INS)