Structure of PDB 3bwv Chain B |
>3bwvB (length=168) Species: 176280 (Staphylococcus epidermidis ATCC 12228) [Search protein sequence] |
RQRIAIDMDEVLADTLGAVVKAVNERADLNIKMESLNGKKLGLVMDILKE PGFFRNLDVMPHAQEVVKQLNEHYDIYIATAAMDVPTSFHDKYEWLLEYF PFLDPQHFVFCGRKNIILADYLIDDNPKQLEIFEGKSIMFTASHNVYEHR FERVSGWRDVKNYFNSIE |
|
PDB | 3bwv Crystal structure of deoxyribonucleotidase-like protein (NP_764060.1) from Staphylococcus epidermidis ATCC 12228 at 1.55 A resolution |
Chain | B |
Resolution | 1.55 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
D9 D11 |
Catalytic site (residue number reindexed from 1) |
D7 D9 |
Enzyme Commision number |
3.1.3.- |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
B |
D9 D11 D135 |
D7 D9 D125 |
|
|
|
|