Structure of PDB 3bvb Chain B

Receptor sequence

>3bvbB (length=99) Species: 11676 (Human immunodeficiency virus 1)

PQITLWKRPLVTIKIGGQLKEALLNTGADDTVIEEMSLPGRWKPKMIGGI
GGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF

3D structure

• PDB: 3bvb Effect of the Active Site D25N Mutation on the Structure, Stability, and Ligand Binding of the Mature HIV-1 Protease.
• Chain: B
• Resolution: 1.3 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): N25 T26 G27
• Catalytic site (residue number reindexed from 1): N25 T26 G27
• Enzyme Commision number: 2.7.7.-
  2.7.7.49: RNA-directed DNA polymerase.
  2.7.7.7: DNA-directed DNA polymerase.
  3.1.-.-
  3.1.13.2: exoribonuclease H.
  3.1.26.13: retroviral ribonuclease H.
  3.4.23.16: HIV-1 retropepsin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	017	B	N25 G27 A28 D29 G48 G49 I50	N25 G27 A28 D29 G48 G49 I50	MOAD: Ka=3170000M^-1 PDBbind-CN: -logKd/Ki=5.49,Kd=3.2uM

Gene Ontology

Molecular Function

• GO:0004190 aspartic-type endopeptidase activity

Biological Process

• GO:0006508 proteolysis

External links

• PDB: RCSB:3bvb, PDBe:3bvb, PDBj:3bvb
• PDBsum: 3bvb
• PubMed: 18281688
• UniProt: P03367|POL_HV1BR Gag-Pol polyprotein (Gene Name=gag-pol)