Structure of PDB 3bd5 Chain B |
>3bd5B (length=112) Species: 10090 (Mus musculus) [Search protein sequence] |
LVMSQSPSSLAVSAGEKVTMSCKSSQSLFNSRTRKNYLAWYQQKPGQSPK LLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSYYHM YTFGSGTKLEIK |
|
PDB | 3bd5 Crystal structure of single-domain VL of an anti-DNA binding antibody 3D8 scFv and its active site revealed by complex structures of a small molecule and metals |
Chain | B |
Resolution | 2.0 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CO |
B |
Y196 L197 Y213 W214 |
Y37 L38 Y54 W55 |
|
|
|