Structure of PDB 3b86 Chain B

Receptor sequence

>3b86B (length=124) Species: 7227 (Drosophila melanogaster)

MTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNFPPSQDLMCYTKC
VSLMAGSVNKKGEFNAPKALAQLPHLVPPEMMEMSRKSVEACRDTHKQFK
ESCERVYQTAKCFSENADGQFMWP

3D structure

• PDB: 3b86 The role of multiple hydrogen-bonding groups in specific alcohol binding sites in proteins: insights from structural studies of LUSH.
• Chain: B
• Resolution: 2.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	EOH	B	S52 S57 T109 F113	S52 S57 T109 F113

Gene Ontology

Molecular Function

• GO:0005549 odorant binding
• GO:0005550 pheromone binding
• GO:0035274 diphenyl phthalate binding
• GO:0035275 dibutyl phthalate binding
• GO:0035276 ethanol binding

Biological Process

• GO:0007608 sensory perception of smell
• GO:0007619 courtship behavior
• GO:0019236 response to pheromone
• GO:0042048 olfactory behavior
• GO:0045471 response to ethanol

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:3b86, PDBe:3b86, PDBj:3b86
• PDBsum: 3b86
• PubMed: 18234222
• UniProt: O02372|OB76A_DROME General odorant-binding protein lush (Gene Name=lush)