Structure of PDB 3b6x Chain B

Receptor sequence
>3b6xB (length=125) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
HMTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNFPPSQDLMCYTK
CVALMAGTVNKKGEFNAPKALAQLPHLVPPEMMEMSRKSVEACRDTHKQF
KESCERVYQTAKCFSENADGQFMWP
3D structure
PDB3b6x The role of multiple hydrogen-bonding groups in specific alcohol binding sites in proteins: insights from structural studies of LUSH.
ChainB
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 1BO B A52 T57 F64 T109 A110 F113 A53 T58 F65 T110 A111 F114
Gene Ontology
Molecular Function
GO:0005549 odorant binding
GO:0005550 pheromone binding
GO:0035274 diphenyl phthalate binding
GO:0035275 dibutyl phthalate binding
GO:0035276 ethanol binding
Biological Process
GO:0007608 sensory perception of smell
GO:0007619 courtship behavior
GO:0019236 response to pheromone
GO:0042048 olfactory behavior
GO:0045471 response to ethanol
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3b6x, PDBe:3b6x, PDBj:3b6x
PDBsum3b6x
PubMed18234222
UniProtO02372|OB76A_DROME General odorant-binding protein lush (Gene Name=lush)

[Back to BioLiP]