Structure of PDB 3b6j Chain B

Receptor sequence
>3b6jB (length=197) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
AKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKA
GGKTQTAPVATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASG
ALYGKLASVFSSTGTGGGQEQTITSTWTTLAHHGMVIVPIGYAAQELFDV
SQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKLNG
3D structure
PDB3b6j Crystal structure of the NADH:quinone oxidoreductase WrbA from Escherichia coli.
ChainB
Resolution2.05 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.6.5.2: NAD(P)H dehydrogenase (quinone).
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FMN B S10 M11 Y12 H14 I15 P77 T78 R79 F80 S113 T114 G115 G118 S9 M10 Y11 H13 I14 P76 T77 R78 F79 S112 T113 G114 G117
BS02 NAD B Y12 M43 A51 D169 G170 Y11 M42 A50 D168 G169
BS03 AMP B A145 Q146 E147 S180 Y184 E187 A144 Q145 E146 S179 Y183 E186
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0003955 NAD(P)H dehydrogenase (quinone) activity
GO:0008753 NADPH dehydrogenase (quinone) activity
GO:0010181 FMN binding
GO:0016491 oxidoreductase activity
GO:0042802 identical protein binding
GO:0050136 NADH:ubiquinone reductase (non-electrogenic) activity
GO:0050660 flavin adenine dinucleotide binding
GO:0050661 NADP binding
GO:0051287 NAD binding
Biological Process
GO:0006979 response to oxidative stress
Cellular Component
GO:0005829 cytosol
GO:0016020 membrane
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3b6j, PDBe:3b6j, PDBj:3b6j
PDBsum3b6j
PubMed17951395
UniProtP0A8G6|NQOR_ECOLI NAD(P)H dehydrogenase (quinone) (Gene Name=wrbA)

[Back to BioLiP]