Structure of PDB 3b4y Chain B

Receptor sequence
>3b4yB (length=332) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]
ELKLGYKASAEQFAPRELVELAVAAEAHGMDSATVSDHFQPWRHQGGHAP
FSLSWMTAVGERTNRLLLGTSVLTPTFRYNPAVIAQAFATMGCLYPNRVF
LGVGTGEALNEIATGYEGAWPEFKERFARLRESVGLMRQLWSGDRVDFDG
DYYRLKGASIYDVPDGGVPVYIAAGGPAVAKYAGRAGDGFICTSGKGEEL
YTEKLMPAVREGAAAADRSVDGIDKMIEIKISYDPDPELAMNNTRFWAPL
SLTAEQKHSIDDPIEMEKAADALPIEQIAKRWIVASDPDEAVEKVGQYVT
WGLNHLVFHAPGHDQRRFLELFQSDLAPRLRR
3D structure
PDB3b4y Crystal structures of F420-dependent glucose-6-phosphate dehydrogenase FGD1 involved in the activation of the anti-tuberculosis drug candidate PA-824 reveal the basis of coenzyme and substrate binding
ChainB
Resolution1.95 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) M32 H40 W44 E109
Catalytic site (residue number reindexed from 1) M30 H38 W42 E107
Enzyme Commision number 1.1.98.2: glucose-6-phosphate dehydrogenase (coenzyme-F420).
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 F42 B S38 D39 H40 S73 V74 T76 T107 G108 E109 F125 A175 G177 G178 P179 A180 V181 T195 H260 S36 D37 H38 S71 V72 T74 T105 G106 E107 F123 A173 G175 G176 P177 A178 V179 T193 H258 MOAD: Kd=4.5uM
BS02 FLC B W44 E109 T195 K198 K232 L252 K259 H260 R283 W42 E107 T193 K196 K230 L250 K257 H258 R281 MOAD: ic50=43uM
Gene Ontology
Molecular Function
GO:0016491 oxidoreductase activity
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0052749 glucose-6-phosphate dehydrogenase (coenzyme F420) activity
GO:0070967 coenzyme F420 binding
Biological Process
GO:0005975 carbohydrate metabolic process
GO:0045454 cell redox homeostasis
Cellular Component
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0009274 peptidoglycan-based cell wall

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3b4y, PDBe:3b4y, PDBj:3b4y
PDBsum3b4y
PubMed18434308
UniProtP9WNE1|FGD_MYCTU F420-dependent glucose-6-phosphate dehydrogenase (Gene Name=fgd1)

[Back to BioLiP]