Structure of PDB 3b0k Chain B

Receptor sequence
>3b0kB (length=120) Species: 9925 (Capra hircus) [Search protein sequence]
MQLTKCEVFQKLKDLKDYGGVSLPEWVCTAFHTSGYDTQAIVQNNDSTEY
GLFQINNKIWCKDDQNPHSRNICNISCDKFLDDDLTDDIVCAKKILDKVG
INYWLAHKALCSEKLDQWLC
3D structure
PDB3b0k Structural insights into the stability perturbations induced by N-terminal variation in human and goat alpha-lactalbumin
ChainB
Resolution1.6 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) T33 N45 S47 E49 N56
Catalytic site (residue number reindexed from 1) T33 N45 S47 E49 N56
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA B K79 D82 D84 D87 D88 K79 D82 D84 D87 D88
Gene Ontology
Molecular Function
GO:0003796 lysozyme activity
GO:0004461 lactose synthase activity
GO:0005509 calcium ion binding
GO:0046872 metal ion binding
Biological Process
GO:0005989 lactose biosynthetic process
GO:0050829 defense response to Gram-negative bacterium
GO:0050830 defense response to Gram-positive bacterium
Cellular Component
GO:0005576 extracellular region
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3b0k, PDBe:3b0k, PDBj:3b0k
PDBsum3b0k
PubMed23155056
UniProtP00712|LALBA_CAPHI Alpha-lactalbumin (Gene Name=LALBA)

[Back to BioLiP]