Structure of PDB 3ayz Chain B

Receptor sequence

>3ayzB (length=273) Species: 28885 (Hydrogenovibrio marinus)

PRTPVIWLHGLECTCCSESFIRSAHPLAKDVVLSMISLDYDDTLMAASGH
AAEAILDEIKEKYKGNYILAVEGNPPLNQDGMSCIIGGRPFSEQLKRMAD
DAKAIISWGSCASWGCVQAAKPNPTQATPVHKFLGGGYDKPIIKVPGCPP
IAEVMTGVITYMLTFDRIPELDRQGRPKMFYSQRIHDKCYRRPHFDAGQF
VEEWDDEGARKGYCLYKVGCKGPTTYNACSTVRWNGGTSFPIQSGHGCIG
CSEDGFWDKGSFYSRDTEMNAFG

3D structure

• PDB: 3ayz Structural basis for a [4Fe-3S] cluster in the oxygen-tolerant membrane-bound [NiFe]-hydrogenase
• Chain: B
• Resolution: 1.22 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C23 C26 C121 C158 H196 C199 C224 C230 C239 P251 C258 C261
• Catalytic site (residue number reindexed from 1): C13 C16 C111 C148 H186 C189 C214 C220 C229 P241 C248 C251
• Enzyme Commision number: 1.12.99.6: hydrogenase (acceptor).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	F4S	B	C23 C25 C26 C121 C126 C158	C13 C15 C16 C111 C116 C148
BS02	SF3	B	C23 T24 C25 C26 E82 C121 C126 C158	C13 T14 C15 C16 E72 C111 C116 C148
BS03	F3S	B	N237 C239 W244 P251 C258 I259 C261	N227 C229 W234 P241 C248 I249 C251
BS04	SF4	B	H196 C199 R201 R202 C224 L225 Y226 C230 P233 I252	H186 C189 R191 R192 C214 L215 Y216 C220 P223 I242

Gene Ontology

Molecular Function

• GO:0008901 ferredoxin hydrogenase activity
• GO:0051536 iron-sulfur cluster binding

Cellular Component

• GO:0009375 ferredoxin hydrogenase complex

External links

• PDB: RCSB:3ayz, PDBe:3ayz, PDBj:3ayz
• PDBsum: 3ayz
• PubMed: 22002607
• UniProt: F2Z6J5