Structure of PDB 3aq5 Chain B

Receptor sequence
>3aq5B (length=117) Species: 5908 (Tetrahymena pyriformis) [Search protein sequence]
QTIYEKLGGENAMKAAVPLFYKKVLADERVKHFFKNTDMDHQTKQQTDFL
TMLLGGPNHYKGKNMTEAHKGMNLQNLHFDAIIENLAATLKELGVTDAVI
NEAAKVIEHTRKDMLGK
3D structure
PDB3aq5 A hydrogen-bonding network formed by the B10-E7-E11 residues of a truncated hemoglobin from Tetrahymena pyriformis is critical for stability of bound oxygen and nitric oxide detoxification.
ChainB
Resolution1.78 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM B F37 F38 T41 Q46 Q50 F53 Y64 G66 K67 M69 H73 M76 L78 H82 F83 I86 M118 F33 F34 T37 Q42 Q46 F49 Y60 G62 K63 M65 H69 M72 L74 H78 F79 I82 M114
BS02 OXY B Y25 Q50 Y21 Q46
Gene Ontology
Molecular Function
GO:0005344 oxygen carrier activity
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0015671 oxygen transport

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3aq5, PDBe:3aq5, PDBj:3aq5
PDBsum3aq5
PubMed21298303
UniProtP17724|TRHBN_TETPY Group 1 truncated hemoglobin

[Back to BioLiP]