Structure of PDB 3ae4 Chain B

Receptor sequence
>3ae4B (length=239) Species: 9823 (Sus scrofa) [Search protein sequence]
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDST
LTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVI
KDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYEC
ILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQD
PFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
3D structure
PDB3ae4 Crystal structure of porcine heart mitochondrial complex II bound with 2-Iodo-N-methyl-benzamide
ChainB
Resolution2.91 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.3.5.1: succinate dehydrogenase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FES B C65 R66 G68 C70 G71 C73 L83 C85 C57 R58 G60 C62 G63 C65 L75 C77
BS02 SF4 B C158 I159 C161 A162 C164 A182 C225 P226 C150 I151 C153 A154 C156 A174 C217 P218
BS03 F3S B C168 S170 P181 C215 M219 N220 C221 C160 S162 P173 C207 M211 N212 C213
BS04 N1M B W173 H216 I218 W165 H208 I210
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008177 succinate dehydrogenase (quinone) activity
GO:0009055 electron transfer activity
GO:0016491 oxidoreductase activity
GO:0046872 metal ion binding
GO:0048039 ubiquinone binding
GO:0051536 iron-sulfur cluster binding
GO:0051537 2 iron, 2 sulfur cluster binding
GO:0051538 3 iron, 4 sulfur cluster binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0006099 tricarboxylic acid cycle
GO:0006121 mitochondrial electron transport, succinate to ubiquinone
GO:0009060 aerobic respiration
GO:0022904 respiratory electron transport chain
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0031966 mitochondrial membrane
GO:0045273 respiratory chain complex II (succinate dehydrogenase)

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3ae4, PDBe:3ae4, PDBj:3ae4
PDBsum3ae4
PubMed
UniProtQ007T0|SDHB_PIG Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial (Gene Name=SDHB)

[Back to BioLiP]