Structure of PDB 3add Chain B

Receptor sequence

>3addB (length=239) Species: 243232 (Methanocaldococcus jannaschii DSM 2661)

HHMLIILTGLPGVGKSTFSKNLAKILSKNNIDVIVLGSDLIRESFPVWKE
KYEEFIKKSTYRLIDSALKNYWVIVDDTNYYNSMRRDLINIAKKYNKNYA
IIYLKASLDVLIRRNIERGEKIPNEVIKKMYEKFDEPGKKYKWDEPFLII
DTTKDIDFNEIAKKLIEKSKEIPKFNISDKIDKETRKIVSEYIKSKKLDK
DKIKEVVELRKEFLKKIKKMEEVDADRVLKEFKDLLNSY

3D structure

• PDB: 3add Structural Basis for the Major Role of O-Phosphoseryl-tRNA Kinase in the UGA-Specific Encoding of Selenocysteine
• Chain: B
• Resolution: 2.4 Å

Enzymatic activity

• Enzyme Commision number: 2.7.1.164: O-phosphoseryl-tRNA(Sec) kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	K55 Y79 N80 S81 M82 R84 D133 K137 K138 Y139 K140 W141 K192 R195 S199 I202 I212 R219 K220	K57 Y81 N82 S83 M84 R86 D135 K139 K140 Y141 K142 W143 K183 R186 S190 I193 I203 R210 K211
BS02	ANP	B	P9 G10 G12 K13 S14 T15 R112 R116 T150	P11 G12 G14 K15 S16 T17 R114 R118 T152

Gene Ontology

Molecular Function

• GO:0005524 ATP binding
• GO:0016301 kinase activity
• GO:0016773 phosphotransferase activity, alcohol group as acceptor
• GO:0043915 L-seryl-tRNA(Sec) kinase activity

Biological Process

• GO:0001717 conversion of seryl-tRNAsec to selenocys-tRNAsec
• GO:0002098 tRNA wobble uridine modification
• GO:0016310 phosphorylation

External links

• PDB: RCSB:3add, PDBe:3add, PDBj:3add
• PDBsum: 3add
• PubMed: 20705242
• UniProt: Q58933|PSTK_METJA L-seryl-tRNA(Sec) kinase (Gene Name=pstK)