Structure of PDB 3adb Chain B

Receptor sequence

>3adbB (length=247) Species: 243232 (Methanocaldococcus jannaschii DSM 2661)

MNHHHHHMLIILTGLPGVGKSTFSKNLAKILSKNNIDVIVLGSDLIRESF
PVWKEKYEEFIKKSTYRLIDSALKNYWVIVDDTNYYNSMRRDLINIAKKY
NKNYAIIYLKASLDVLIRRNIERGEKIPNEVIKKMYEKFDEPGKKYKWDE
PFLIIDTTKDIDFNEIAKKLIEKSKEIPKFKNNNISDKIDKETRKIVSEY
IKSKKLDKDKIKEVVELRKEFLKKIKKMEEVDADRVLKEFKDLLNSY

3D structure

• PDB: 3adb Structural Basis for the Major Role of O-Phosphoseryl-tRNA Kinase in the UGA-Specific Encoding of Selenocysteine
• Chain: B
• Resolution: 2.8 Å

Enzymatic activity

• Enzyme Commision number: 2.7.1.164: O-phosphoseryl-tRNA(Sec) kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	W46 E48 E51 K55 Y78 Y79 N80 S81 M82 R84 I120 V124 M128 D133 K137 K138 Y139 K140 W141 D188 D191 R195 S199 I202 I212 V216 R219 K220 K227 K228	W53 E55 E58 K62 Y85 Y86 N87 S88 M89 R91 I127 V131 M135 D140 K144 K145 Y146 K147 W148 D187 D190 R194 S198 I201 I211 V215 R218 K219 K226 K227	PDBbind-CN: Kd=39nM
BS02	ANP	B	G10 G12 K13 S14 T15 R112 R116	G17 G19 K20 S21 T22 R119 R123

Gene Ontology

Molecular Function

• GO:0005524 ATP binding
• GO:0016301 kinase activity
• GO:0016773 phosphotransferase activity, alcohol group as acceptor
• GO:0043915 L-seryl-tRNA(Sec) kinase activity

Biological Process

• GO:0001717 conversion of seryl-tRNAsec to selenocys-tRNAsec
• GO:0002098 tRNA wobble uridine modification
• GO:0016310 phosphorylation

External links

• PDB: RCSB:3adb, PDBe:3adb, PDBj:3adb
• PDBsum: 3adb
• PubMed: 20705242
• UniProt: Q58933|PSTK_METJA L-seryl-tRNA(Sec) kinase (Gene Name=pstK)